Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria MAP_1030 protein

This Bacteria MAP_1030 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP_1030, Probable transcriptional regulatory protein MAP_1030

UniProt

P62039

Expression Region

1-250aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC4 Polyclonal Antibody
E-AB-18317-01 20 µL

XRCC4 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4 Polyclonal Antibody
E-AB-18317-02 60 µL

XRCC4 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4 Polyclonal Antibody
E-AB-18317-03 120 µL

XRCC4 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4 Polyclonal Antibody
E-AB-18317-04 200 µL

XRCC4 Polyclonal Antibody

Sign In for Pricing
View Details
SIM1 Rabbit Polyclonal Antibody (Cy7)
orb1011408 100 µL

SIM1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Anti-MLC1 Antibody Picoband®, APC Conjugate
A02920-1-APC 100 µg/Vial

Anti-MLC1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details