Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GSP1 protein

This Virus GSP1 protein spans the amino acid sequence from region 2-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chromosome stability protein 17 (GTPase Ran homolog) (Genetic suppressor of PRP20-1) (CNR1) (CST17)

UniProt

P32835

Expression Region

2-219aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK9 modulator-3
HY-146084 1 Each

PCSK9 modulator-3

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PLCL1 Protein, His (Fc)-Avi-tagged
PLCL1-3281R 50 µg

Recombinant Rhesus Macaque PLCL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
3’,5’, N2-Tri-O-acetyl 2’-Deoxyguanosine
022077 500 mg

3’,5’, N2-Tri-O-acetyl 2’-Deoxyguanosine

Sign In for Pricing
View Details
GATA3 antibody
FNab03361 100 µg

GATA3 antibody

Sign In for Pricing
View Details
Anti-ACACA Antibody Picoband®, Carrier-free
A01802-3-carrier-free 100 µg/Vial

Anti-ACACA Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Human SCYL1 shRNA Plasmid
abx961436-01 150 µg

Human SCYL1 shRNA Plasmid

Sign In for Pricing
View Details