Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pcnt protein

This Mouse Pcnt protein spans the amino acid sequence from region 2545-2810aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pcnt2

UniProt

P48725

Expression Region

2545-2810aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope Slides Cuscuta Haustoria VS
4041750/3 1 Each

Microscope Slides Cuscuta Haustoria VS

Sign In for Pricing
View Details
RAD51C siRNA (Mouse)
CRN1208-01 15 nmol

RAD51C siRNA (Mouse)

Sign In for Pricing
View Details
RAD51C siRNA (Mouse)
CRN1208-02 30 nmol

RAD51C siRNA (Mouse)

Sign In for Pricing
View Details
Rps23 Rabbit Polyclonal Antibody (HRP)
orb2091233 100 µL

Rps23 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (Azide free) (HRP) discontinued
044167-HRP 200 µL

ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
HADHSC Rabbit Polyclonal Antibody (BF405)
orb2555324 100 µL

HADHSC Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details