Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps23 Rabbit Polyclonal Antibody (HRP)

Rps23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P62268

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rps23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_511172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF, Others Antibody
orb3031975-01 5 mg

TNF, Others Antibody

Sign In for Pricing
View Details
TNF, Others Antibody
orb3031975-02 1 mg

TNF, Others Antibody

Sign In for Pricing
View Details
Anti-GJB2 Antibody Picoband® Fluoro488 Conjugated
A00512-2-Fluoro488 100 µg/Vial

Anti-GJB2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit
MBS7206608-01 48 Well

Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit
MBS7206608-02 96 Well

Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit
MBS7206608-03 5x 96 Well

Rabbit Lambda-crystallin homolog (CRYL1) ELISA Kit

Sign In for Pricing
View Details