Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pde5a protein

This Mouse Pde5a protein spans the amino acid sequence from region 154-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)

UniProt

Q8CG03

Expression Region

154-320aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncharacterized protein C3orf20 (C3orf20) Human ELISA Kit
I1033 96 Tests

Uncharacterized protein C3orf20 (C3orf20) Human ELISA Kit

Sign In for Pricing
View Details
ASAP1 Knockout MES-OV Polyclonal Cells
ARG24241 1 Million

ASAP1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Dihydro-5-azacytidine
HY-106689 1 Each

Dihydro-5-azacytidine

Sign In for Pricing
View Details
Polypropylene 81-place box with color bottom and clear lid, pink, 5 1/8" L x 5 1/8" W x 1 7/8" H, 5/pack
2381-5044 5/PCK

Polypropylene 81-place box with color bottom and clear lid, pink, 5 1/8" L x 5 1/8" W x 1 7/8" H, 5/pack

Sign In for Pricing
View Details
Protease Activity Assay Kit
AR4011-unit 1 Unit

Protease Activity Assay Kit

Sign In for Pricing
View Details
Lentiviral mouse Sult5a1 shRNA (UAS) - Lentiviral mouse Sult5a1 shRNA (UAS) (25)
GTR15166985 1 Vial

Lentiviral mouse Sult5a1 shRNA (UAS) - Lentiviral mouse Sult5a1 shRNA (UAS) (25)

Sign In for Pricing
View Details