Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifna7 protein

This Mouse Ifna7 protein spans the amino acid sequence from region 24-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-alpha-7 (Ifa7)

UniProt

P06799

Expression Region

24-190aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC500594 (NM_001047958) Rat Tagged ORF Clone
RR215303 10 µg

LOC500594 (NM_001047958) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PCp-Cy5
orb63300 20 ul

PCp-Cy5

Sign In for Pricing
View Details
Chicken Calcium Binding Protein D9K ELISA Kit
MBS7264620-01 48 Well

Chicken Calcium Binding Protein D9K ELISA Kit

Sign In for Pricing
View Details
Chicken Calcium Binding Protein D9K ELISA Kit
MBS7264620-02 96 Well

Chicken Calcium Binding Protein D9K ELISA Kit

Sign In for Pricing
View Details
Chicken Calcium Binding Protein D9K ELISA Kit
MBS7264620-03 5x 96 Well

Chicken Calcium Binding Protein D9K ELISA Kit

Sign In for Pricing
View Details
Chicken Calcium Binding Protein D9K ELISA Kit
MBS7264620-04 10x 96 Well

Chicken Calcium Binding Protein D9K ELISA Kit

Sign In for Pricing
View Details