Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nqo1 protein

This Mouse Nqo1 protein spans the amino acid sequence from region 2-274aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Azoreductase (DT-diaphorase) (DTD) (Menadione reductase) (NAD (P) H, quinone oxidoreductase 1) (Phylloquinone reductase) (Quinone reductase 1) (QR1) (Dia4) (Nmo1) (Nmor1)

UniProt

Q64669

Expression Region

2-274aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Rac) -Vepdegestrant
orb3143484-01 10 mg

(Rac) -Vepdegestrant

Sign In for Pricing
View Details
(Rac) -Vepdegestrant
orb3143484-02 50 mg

(Rac) -Vepdegestrant

Sign In for Pricing
View Details
UBAP1 Rabbit Polyclonal Antibody (Biotin)
orb2083960 100 µL

UBAP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BD1, aa1-36 (beta Defensin-1)
B0899-03G-01 10 µg

BD1, aa1-36 (beta Defensin-1)

Sign In for Pricing
View Details
BD1, aa1-36 (beta Defensin-1)
B0899-03G-02 100 µg

BD1, aa1-36 (beta Defensin-1)

Sign In for Pricing
View Details
TM173, CT (TMEM173, ERIS, MITA, STING, Transmembrane protein 173, Endoplasmic reticulum interferon stimulator, Mediator of IRF3 activation, Stimulator of interferon genes protein) (MaxLight 750) discontinued
042892-ML750 100 µL

TM173, CT (TMEM173, ERIS, MITA, STING, Transmembrane protein 173, Endoplasmic reticulum interferon stimulator, Mediator of IRF3 activation, Stimulator of interferon genes protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details