Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Apolipoprotein AI protein

This Bovine Apolipoprotein AI protein spans the amino acid sequence from region 25-265aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein A1 (Apo-AI) (ApoA-I)

UniProt

P15497

Expression Region

25-265aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 660 succinimidyl ester
1032-AAT 1 mg

IFluor® 660 succinimidyl ester

Sign In for Pricing
View Details
BTLA (BTLA/1528), Biotin conjugate, 0.1mg/mL
BNCB1528-100 1x 100 µL

BTLA (BTLA/1528), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TGF beta 1 Monoclonal Antibody
AN301902L-01 50 µL

Recombinant TGF beta 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TGF beta 1 Monoclonal Antibody
AN301902L-02 100 µL

Recombinant TGF beta 1 Monoclonal Antibody

Sign In for Pricing
View Details
Shc2 Mouse Gene Knockout Kit (CRISPR)
KN515740 1 Kit

Shc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNFAIP3 (NM_006290) Human Recombinant Protein
TP321337M 100 µg

TNFAIP3 (NM_006290) Human Recombinant Protein

Sign In for Pricing
View Details