Human MOG protein
This Human MOG protein spans the amino acid sequence from region 30-154aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, MOG AluA, MOG AluB, MOG, MOG Ig AluB, MOG_HUMAN, MOGIG2, Myelin oligodendrocyte glycoprotein, Myelin-oligodendrocyte glycoprotein, NRCLP7
UniProt
Q16653
Expression Region
30-154aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3529-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881148-500 1x 500 µL
CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-H5574-01 24 Tests
Human COX2 (Cytochrome C Oxidase Subunit II) ELISA Kit
Sign In for Pricing
View Details E-EL-H5574-02 48 Tests
Human COX2 (Cytochrome C Oxidase Subunit II) ELISA Kit
Sign In for Pricing
View Details