Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OLIG1 protein

This Human OLIG1 protein spans the amino acid sequence from region 17-105aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Class B basic helix-loop-helix protein 6 Short name, bHLHb6 Class E basic helix-loop-helix protein 21 Short name, bHLHe21

UniProt

Q8TAK6

Expression Region

17-105aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-L-Tyr (2-azidoethyl) -OH
HY-151687 1 Each

Fmoc-L-Tyr (2-azidoethyl) -OH

Sign In for Pricing
View Details
Chicken Tubulin Folding Cofactor B ELISA Kit
MBS7265640-01 48 Well

Chicken Tubulin Folding Cofactor B ELISA Kit

Sign In for Pricing
View Details
Chicken Tubulin Folding Cofactor B ELISA Kit
MBS7265640-02 96 Well

Chicken Tubulin Folding Cofactor B ELISA Kit

Sign In for Pricing
View Details
Chicken Tubulin Folding Cofactor B ELISA Kit
MBS7265640-03 5x 96 Well

Chicken Tubulin Folding Cofactor B ELISA Kit

Sign In for Pricing
View Details
Chicken Tubulin Folding Cofactor B ELISA Kit
MBS7265640-04 10x 96 Well

Chicken Tubulin Folding Cofactor B ELISA Kit

Sign In for Pricing
View Details
TPT Antibody
orb842741 2 mg

TPT Antibody

Sign In for Pricing
View Details