Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REL protein

This Human REL protein spans the amino acid sequence from region 3-616aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Avian reticuloendotheliosis , C REL, C Rel protein, c Rel proto oncogene protein, Oncogene REL , Oncogene REL avian reticuloendotheliosis, Proto-oncogene c-Rel, REL, REL_HUMAN, v rel avian reticuloendotheliosis viral oncogene homolog, v rel reticuloendotheliosis viral oncogene homolog , V rel reticuloendotheliosis viral oncogene homolog (avian)

UniProt

Q04864

Expression Region

3-616aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Interferon Gamma (IFNg) ELISA Kit
orb1661266-01 48 Tests

Bovine Interferon Gamma (IFNg) ELISA Kit

Sign In for Pricing
View Details
Bovine Interferon Gamma (IFNg) ELISA Kit
orb1661266-02 96 Tests

Bovine Interferon Gamma (IFNg) ELISA Kit

Sign In for Pricing
View Details
PMS2 Antibody
CSB-PA782127-01 50 μL

PMS2 Antibody

Sign In for Pricing
View Details
PMS2 Antibody
CSB-PA782127-02 100 µL

PMS2 Antibody

Sign In for Pricing
View Details
ING3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2497972 100 µL

ING3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
DM3
orb1992881-01 100 mg

DM3

Sign In for Pricing
View Details