Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTP1 protein

This Human GSTP1 protein spans the amino acid sequence from region 2-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-piGSTP1-1

UniProt

P09211

Expression Region

2-210aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR3L (NM_001195259) Human Tagged ORF Clone
RC231159 10 µg

TGFBR3L (NM_001195259) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)
orb2919324-01 20 µg

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)
orb2919324-02 100 µg

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
RN5S512 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV745857 1.0 µg DNA

RN5S512 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Anti-PLXNB1 Antibody (C-term)
M02711-400ul 400 µL

Anti-PLXNB1 Antibody (C-term)

Sign In for Pricing
View Details
Chicken anti Botulinum Neurotoxin Type A (Heavy Chain Binding Domain)
AHcA 0.1 mg

Chicken anti Botulinum Neurotoxin Type A (Heavy Chain Binding Domain)

Sign In for Pricing
View Details