Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OSM protein

This Human OSM protein spans the amino acid sequence from region 26-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MGC20461, ONCM_HUMAN, Oncostatin M, Oncostatin-M, OSM

UniProt

P13725

Expression Region

26-220aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Serpentine receptor class T-55 (srt-55)
orb2905544-01 20 µg

Recombinant Serpentine receptor class T-55 (srt-55)

Sign In for Pricing
View Details
Recombinant Serpentine receptor class T-55 (srt-55)
orb2905544-02 100 µg

Recombinant Serpentine receptor class T-55 (srt-55)

Sign In for Pricing
View Details
TMPRSS11B (Transmembrane Protease Serine 11B, Airway Trypsin-like Protease 5, HATL5)
MBS641717-01 0.05 mg

TMPRSS11B (Transmembrane Protease Serine 11B, Airway Trypsin-like Protease 5, HATL5)

Sign In for Pricing
View Details
TMPRSS11B (Transmembrane Protease Serine 11B, Airway Trypsin-like Protease 5, HATL5)
MBS641717-02 5x 0.05 mg

TMPRSS11B (Transmembrane Protease Serine 11B, Airway Trypsin-like Protease 5, HATL5)

Sign In for Pricing
View Details
Recombinant Clostridium tetani Redox-sensing transcriptional repressor rex (rex)
MBS1448764-01 0.02 mg (E-Coli)

Recombinant Clostridium tetani Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details
Recombinant Clostridium tetani Redox-sensing transcriptional repressor rex (rex)
MBS1448764-02 0.1 mg (E-Coli)

Recombinant Clostridium tetani Redox-sensing transcriptional repressor rex (rex)

Sign In for Pricing
View Details