Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class T-55 (srt-55)

This Recombinant Serpentine receptor class T-55 (srt-55) spans the amino acid sequence from region 19-363.

Product Specifications

Product Name Alternative

Serpentine receptor class T-55, Protein srt-55

UniProt

P34571

Expression Region

19-363

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ICFDLKTLQCWPMEIQEMALMLTARNTARYDCSGKSKSEWYETGQKRLGWGIYYISSGLF FQLIGWPVIWVFITKFSMTNALKVYRIMVFIGLIEITEIWGNSVFPGFVAVFGEVYCTSP ILMTIVGKMTMVQWVLGSSSAAFLGFHRLCDMIQKLEWLVNTNTKTGLWLTVLFFYACYG SIFFDTVLFNSDYMAPLLDPMIGKQGIIYSNNFLYFHNIIVATTLILVYACLCTLWSSRE MNTSSLHVSKFQRSILLQSICISLTYAIPAISFVTMFVLPIPKWFFHVSDITYQLSGGLP FIMYICLNKRVREEFLHLLRVCRKAEKSQVAVIPLGNSTVSAFNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDG1 (S1PR1) (NM_001400) Human Tagged ORF Clone Lentiviral Particle
RC204608L1V 200 µL

EDG1 (S1PR1) (NM_001400) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ACSL6 (NM_001009185) Human Recombinant Protein
TP311883L 1 mg

ACSL6 (NM_001009185) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Occludin/OCLN Antibody Picoband® (iFluor647 Conjugate)
RP1057-iFluor647 100 µg

Anti-Occludin/OCLN Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
BioF Antibody
orb810796 2 mg

BioF Antibody

Sign In for Pricing
View Details
TMPRSS7 Lentiviral Activation Particles (m)
sc-431547-LAC 200 µL

TMPRSS7 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
NME6 Rabbit Polyclonal Antibody (APC)
orb2586592 100 µg

NME6 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details