Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus UL128 protein

This Virus UL128 protein spans the amino acid sequence from region 1-171aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL128Uncharacterized protein UL128

UniProt

P16837

Expression Region

1-171aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Trans-2-enoyl-CoA reductase, mitochondrial (MECR) ELISA Kit
EK9753 48 Tests

Human Trans-2-enoyl-CoA reductase, mitochondrial (MECR) ELISA Kit

Sign In for Pricing
View Details
SLC39A6 Rabbit Polyclonal Antibody (PE-Cy7)
orb950823 100 µL

SLC39A6 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
HIST1H2BD CRISPR Knock Out 293T Cell Line (Human)
23338141 1x 10^6 Cells / 1.0 mL

HIST1H2BD CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-BK Beta3a K+ Channel Antibody
11528-1 100 µg

Anti-BK Beta3a K+ Channel Antibody

Sign In for Pricing
View Details
ORF007L (NC_003494) Virus Tagged ORF Clone
VC102297 10 µg

ORF007L (NC_003494) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Human KCNA7 (NM_031886) AAV Particle
RC222164A1V 250 µL

Human KCNA7 (NM_031886) AAV Particle

Sign In for Pricing
View Details