Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant nifH protein

This Plant nifH protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase

UniProt

P20623

Expression Region

1-47aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rhizobium leguminosarum

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROP1 Protein (N-GST & C-His, Human)
P507423 100 µg

PROP1 Protein (N-GST & C-His, Human)

Sign In for Pricing
View Details
Recombinant Rat Proline-rich membrane anchor 1 (Prima1), partial
MBS7056702 Inquire

Recombinant Rat Proline-rich membrane anchor 1 (Prima1), partial

Sign In for Pricing
View Details
3’-O- (t-Butyldiphenylsilyl) thymidine
HY-20142 1 Each

3’-O- (t-Butyldiphenylsilyl) thymidine

Sign In for Pricing
View Details
CCL5 Protein (C-Human Fc tag, )
P510728 100 µg

CCL5 Protein (C-Human Fc tag, )

Sign In for Pricing
View Details
NUDT9 CRISPR/Cas9 KO Plasmid (h)
sc-409958 20 µg

NUDT9 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CD11a Recombinant Antibody, PE-Cy7 Conjugated
bsm-61034R-PE-Cy7 100 µL

CD11a Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details