Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate SNCG protein

This Primate SNCG protein spans the amino acid sequence from region 1-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCG, QflA-20719, Gamma-synuclein

UniProt

Q2PFW6

Expression Region

1-127aa

Tag

Tag-Free

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptomyces avermitilis 1,4-alpha-glucan branching enzyme GlgB 2 (glgB2), partial
MBS1459263 Inquire

Recombinant Streptomyces avermitilis 1,4-alpha-glucan branching enzyme GlgB 2 (glgB2), partial

Sign In for Pricing
View Details
Substance P Acetate Salt Hydrate
B2013708 0.5 mg

Substance P Acetate Salt Hydrate

Sign In for Pricing
View Details
AZD 2098
orb1224644-01 1 g

AZD 2098

Sign In for Pricing
View Details
AZD 2098
orb1224644-02 2 mg

AZD 2098

Sign In for Pricing
View Details
AZD 2098
orb1224644-03 5 mg

AZD 2098

Sign In for Pricing
View Details
AZD 2098
orb1224644-04 10 mg

AZD 2098

Sign In for Pricing
View Details