Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPBP protein

This Human PPBP protein spans the amino acid sequence from region 59-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 7Leukocyte-derived growth factor , LDGFMacrophage-derived growth factor , MDGFSmall-inducible cytokine B7

UniProt

P02775

Expression Region

59-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FA2H Overexpression Lysate (Native) - (Dry Ice)
NBL1-10415 0.1 mg

FA2H Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PBRM1-BD2-IN-2
HY-151529 1 mg

PBRM1-BD2-IN-2

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (296712) [PE/Cy7]
FAB2410PECY7 0.1 mL

Mouse Monoclonal CD4 Antibody (296712) [PE/Cy7]

Sign In for Pricing
View Details
Cryptic Double Nickase Plasmid (m2)
sc-419633-NIC-2 20 µg

Cryptic Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 2 (LILRB2) Antibody (PE)
abx270947-01 100 Tests

Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 2 (LILRB2) Antibody (PE)

Sign In for Pricing
View Details
Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 2 (LILRB2) Antibody (PE)
abx270947-02 200 Tests

Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 2 (LILRB2) Antibody (PE)

Sign In for Pricing
View Details