Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGA protein

This Human AGA protein spans the amino acid sequence from region 206-346aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aspartylglucosaminidase, Glycosylasparaginase, N4- (N-acetyl-beta-glucosaminyl) -L-asparagine amidase

UniProt

P20933

Expression Region

206-346aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Ethoxyphenol
sc-256746 5 g

4-Ethoxyphenol

Sign In for Pricing
View Details
Onvatilimab Biosimilar - Research Grade
ICH5081-10mg 10 mg (2x 5 mg)

Onvatilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Mouse Monoclonal Aldolase C Antibody (2E11) [DyLight 550]
NBP2-59408R 0.1 mL

Mouse Monoclonal Aldolase C Antibody (2E11) [DyLight 550]

Sign In for Pricing
View Details
Recombinant human TEF protein
ATGP2170-250 250 µg

Recombinant human TEF protein

Sign In for Pricing
View Details
GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3) (MaxLight 490)
MBS6379445-01 0.1 mL

GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3) (MaxLight 490)

Sign In for Pricing
View Details
GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3) (MaxLight 490)
MBS6379445-02 5x 0.1 mL

GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3) (MaxLight 490)

Sign In for Pricing
View Details