Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Matrix protein 1 protein

This Viral Matrix protein 1 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein 1, M1

UniProt

A4GCL0

Expression Region

1-252aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Influenza A virus (strain A/USA:Iowa/1943 H1N1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-252aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD3 Knockout 786-O Polyclonal Cells
ARG24798 1 Million

ACBD3 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Transglutaminase 2 Polyclonal Antibody, PE Conjugated
bs-6196R-PE 100 µL

Transglutaminase 2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Polyclonal GATA6 Antibody (C-term)
APR17766G 0.1ml

Polyclonal GATA6 Antibody (C-term)

Sign In for Pricing
View Details
CTNNAL1 Human Over-expression Lysate
orb1366046 20 µg

CTNNAL1 Human Over-expression Lysate

Sign In for Pricing
View Details
Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST HB Subunit 4, GTH4, GST1, H-B, MGC26563)
140486 200 µL

Glutathione S-transferase Mu 1 (GST Class-mu 1, GSTM1, GTM1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GST HB Subunit 4, GTH4, GST1, H-B, MGC26563)

Sign In for Pricing
View Details
HNMT, Human (His)
HY-P75811-01 5 µg

HNMT, Human (His)

Sign In for Pricing
View Details