Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT, Human (His)

The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HNMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnmt-protein-human-gst.html

Purity

96.00

Smiles

MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

Molecular Formula

3176 (Gene_ID) AAH20677.1 (M1-A292) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal GIPR Antibody (591827) [PE/Cy5.5]
MAB82102PECY55 0.1 mL

Mouse Monoclonal GIPR Antibody (591827) [PE/Cy5.5]

Ask
View Details
PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b)
217634 100 µL

PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b)

Ask
View Details
Polyclonal Antibody to Aromatase (ARO)
MBS2005149-01 0.1 mL

Polyclonal Antibody to Aromatase (ARO)

Ask
View Details
Polyclonal Antibody to Aromatase (ARO)
MBS2005149-02 0.2 mL

Polyclonal Antibody to Aromatase (ARO)

Ask
View Details
Polyclonal Antibody to Aromatase (ARO)
MBS2005149-03 0.5 mL

Polyclonal Antibody to Aromatase (ARO)

Ask
View Details
Polyclonal Antibody to Aromatase (ARO)
MBS2005149-04 1 mL

Polyclonal Antibody to Aromatase (ARO)

Ask
View Details