Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5B protein

This Human ATP5B protein spans the amino acid sequence from region 230-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATPMB, ATPSB

UniProt

P06576

Expression Region

230-529aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 230-529aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP23-1 Human Gene Knockout Kit (CRISPR)
KN420931 1 Kit

KRTAP23-1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KB-R7943 mesylate
SIH-312-10MG 10 mg

KB-R7943 mesylate

Sign In for Pricing
View Details
FBXW9 (NM_032301) Human Recombinant Protein
TP315951 20 µg

FBXW9 (NM_032301) Human Recombinant Protein

Sign In for Pricing
View Details
MPRA Antibody
8G388-AAT 50 µg

MPRA Antibody

Sign In for Pricing
View Details
NKAPD1 (NM_001082969) Human Over-expression Lysate
LY421200 100 µg

NKAPD1 (NM_001082969) Human Over-expression Lysate

Sign In for Pricing
View Details
C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate
LC422818 20 µg

C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate

Sign In for Pricing
View Details