Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LOX protein

This Human LOX protein spans the amino acid sequence from region 169-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysyl oxidase

UniProt

P28300

Expression Region

169-417aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 169-417aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL-12 (MCP-5)
103-M322 50 µg

CCL-12 (MCP-5)

Sign In for Pricing
View Details
CNDP1 Polyclonal Antibody
JOT-AP15040-01 50ul

CNDP1 Polyclonal Antibody

Sign In for Pricing
View Details
CNDP1 Polyclonal Antibody
JOT-AP15040-02 100ul

CNDP1 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF443 Double Nickase Plasmid (h2)
sc-411435-NIC-2 20 µg

ZNF443 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human DECR1 Protein Lysate
MBS8410403-01 0.02 mg

Human DECR1 Protein Lysate

Sign In for Pricing
View Details
Human DECR1 Protein Lysate
MBS8410403-02 5x 0.02 mg

Human DECR1 Protein Lysate

Sign In for Pricing
View Details