Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL18 protein

This Mouse IL18 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor

UniProt

P70380

Expression Region

1-192aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: C-terminal 6xHis-taggedExpression Region: 1-192aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human GPRC5A (G protein-coupled receptor class C group 5 member A) Full Length
MPC0179K Each

Magic™ Membrane Protein Human GPRC5A (G protein-coupled receptor class C group 5 member A) Full Length

Sign In for Pricing
View Details
PPP3CA Recombinant Protein (Human)
RP024430 100 µg

PPP3CA Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit Anti-GATA3 antibody
SL1452R-01 50 µL

Rabbit Anti-GATA3 antibody

Sign In for Pricing
View Details
Rabbit Anti-GATA3 antibody
SL1452R-02 100 µL

Rabbit Anti-GATA3 antibody

Sign In for Pricing
View Details
SMC3 Rabbit monoclonal antibody
BS40461-01 50 µL

SMC3 Rabbit monoclonal antibody

Sign In for Pricing
View Details
SMC3 Rabbit monoclonal antibody
BS40461-02 100 µL

SMC3 Rabbit monoclonal antibody

Sign In for Pricing
View Details