Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli FABB protein

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-] synthase 1

Product Specifications

Product Name Alternative

3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase I

UniProt

P0A953

Expression Region

1-406aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-406aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7072-5p miRNA Inhibitor
MBS8297004-01 10 nmol

mmu-miR-7072-5p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-7072-5p miRNA Inhibitor
MBS8297004-02 20 nmol

mmu-miR-7072-5p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-7072-5p miRNA Inhibitor
MBS8297004-03 5x 20 nmol

mmu-miR-7072-5p miRNA Inhibitor

Sign In for Pricing
View Details
TEKT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46484124 3x 1.0µg DNA

TEKT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CHUK Antibody : FITC (OAPB00062-FITC)
OAPB00062-100UG-FITC 0.1 mg

CHUK Antibody : FITC (OAPB00062-FITC)

Sign In for Pricing
View Details
1- (1H-pyrazol-5-yl) ethanone
sc-332086A 5 g

1- (1H-pyrazol-5-yl) ethanone

Sign In for Pricing
View Details