Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse NKX3-2 protein

This Mouse NKX3-2 protein spans the amino acid sequence from region 1-333aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog B

UniProt

P97503

Expression Region

1-333aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-333aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN1 (NM_002248) Human Over-expression Lysate
E45H19535-2 20 µg

KCNN1 (NM_002248) Human Over-expression Lysate

Sign In for Pricing
View Details
GMCL1P1 Protein Vector (Human) (pPM-C-His)
PV080964 500 ng

GMCL1P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Stat5 (phospho-S726/731) polyclonal antibody
BS4464-01 50 µL

Stat5 (phospho-S726/731) polyclonal antibody

Sign In for Pricing
View Details
Stat5 (phospho-S726/731) polyclonal antibody
BS4464-02 100 µL

Stat5 (phospho-S726/731) polyclonal antibody

Sign In for Pricing
View Details
PSIP2 Antibody Blocking peptide
orb1459133 500 µg

PSIP2 Antibody Blocking peptide

Sign In for Pricing
View Details
SAR1A AAV siRNA Pooled Vector
43020161 1.0 µg

SAR1A AAV siRNA Pooled Vector

Sign In for Pricing
View Details