Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR034 protein

This Viral VACWR034 protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein K2

UniProt

P18378

Expression Region

1-88aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-88aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 nsp3-IN-1
orb1689172-01 25 mg

SARS-CoV-2 nsp3-IN-1

Sign In for Pricing
View Details
SARS-CoV-2 nsp3-IN-1
orb1689172-02 50 mg

SARS-CoV-2 nsp3-IN-1

Sign In for Pricing
View Details
SARS-CoV-2 nsp3-IN-1
orb1689172-03 100 mg

SARS-CoV-2 nsp3-IN-1

Sign In for Pricing
View Details
Recombinant Human CD300A Protein, His, E.coli-2ug
QP11324-2ug 2ug

Recombinant Human CD300A Protein, His, E.coli-2ug

Sign In for Pricing
View Details
EPOR Protein, Mouse, Recombinant (hFc Tag)
PM53152I4 50 µg

EPOR Protein, Mouse, Recombinant (hFc Tag)

Sign In for Pricing
View Details
NSUN2 HDR Plasmid (h)
sc-405097-HDR 20 µg

NSUN2 HDR Plasmid (h)

Sign In for Pricing
View Details