Yeast ATG8 protein
This Yeast ATG8 protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Autophagy-related ubiquitin-like modifier ATG8
UniProt
Q6FXR8
Expression Region
1-116aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-116aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-PTPN11-Ra-01 96 Tests
Rat Protein Tyrosine Phosphatase, Non Receptor Type 11 (PTPN11) ELISA Kit
Sign In for Pricing
View Details RD-PTPN11-Ra-02 48 Tests
Rat Protein Tyrosine Phosphatase, Non Receptor Type 11 (PTPN11) ELISA Kit
Sign In for Pricing
View Details 
TRC-S687910-25MG 25 mg
(S)-N-(2-(2-Cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide (UAMC1110)
Sign In for Pricing
View Details 
LC422525 20 µg
Calnexin (CANX) (NM_001024649) Human Over-expression Lysate
Sign In for Pricing
View Details ![MGST1 Mouse Monoclonal Antibody [14H2]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81a01/imageurl/em1901-13.webp)
PDEH100821-01 20 µg
Recombinant Human Pancreatic lipase/PL protein (His tag)
Sign In for Pricing
View Details