Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse HAS2 protein

This Mouse HAS2 protein spans the amino acid sequence from region 67-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hyaluronate synthase 2Hyaluronic acid synthase 2 , HA synthase 2

UniProt

P70312

Expression Region

67-374aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 67-374aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Capn2 (NM_009794) Mouse Recombinant Protein
PM45247M5 20 µg

Capn2 (NM_009794) Mouse Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti Goat IgG Fc (HRP)
43R-1088 1 mg

Rabbit anti Goat IgG Fc (HRP)

Sign In for Pricing
View Details
FUT5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0822707 1.0 µg DNA

FUT5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human TMEM107 (NM_183065) AAV Particle
RC223559A1V 250 µL

Human TMEM107 (NM_183065) AAV Particle

Sign In for Pricing
View Details
Mouse Myh13 Pre-designed siRNA Set B
SI108946B 1 Each

Mouse Myh13 Pre-designed siRNA Set B

Sign In for Pricing
View Details
AOX1 ELISA Kit (Bovine) (OKCD09447)
OKCD09447 96 Well

AOX1 ELISA Kit (Bovine) (OKCD09447)

Sign In for Pricing
View Details