Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CHRNA1 protein

This Mouse CHRNA1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chrna1, Acra, Acetylcholine receptor subunit alpha

UniProt

P04756

Expression Region

21-230aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 21-230aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD360/IL21R Antibody (18A5), FITC
HV076117-01 1 Each

Anti-Human CD360/IL21R Antibody (18A5), FITC

Sign In for Pricing
View Details
Anti-Human CD360/IL21R Antibody (18A5), FITC
HV076117-02 100 Tests

Anti-Human CD360/IL21R Antibody (18A5), FITC

Sign In for Pricing
View Details
GRM6 ELISA Kit (Mouse) (OKCA01719)
OKCA01719 96 Well

GRM6 ELISA Kit (Mouse) (OKCA01719)

Sign In for Pricing
View Details
Osteopontin (SPP1) (NM_001040058) Human Tagged Lenti ORF Clone
RC204803L4 10 µg

Osteopontin (SPP1) (NM_001040058) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RNF220 (NM_018150) Human Recombinant Protein
PH38689M5 20 µg

RNF220 (NM_018150) Human Recombinant Protein

Sign In for Pricing
View Details
LIAS (NM_006859) Human Over-expression Lysate
LH18402V 100 µg

LIAS (NM_006859) Human Over-expression Lysate

Sign In for Pricing
View Details