Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Anionic trypsin protein

This Dog Anionic trypsin protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anionic trypsin, EC 3.4.21.4

UniProt

P06872

Expression Region

24-247aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-SUMO-tagged1-391AA: 24-247AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIgG-hFc receptor-IN-1
HY-145775 1 Each

HIgG-hFc receptor-IN-1

Sign In for Pricing
View Details
ER Degradation-Enhancing Alpha-Mannosidase-Like Protein 3 (EDEM3) Antibody
abx028901-01 80 µL

ER Degradation-Enhancing Alpha-Mannosidase-Like Protein 3 (EDEM3) Antibody

Sign In for Pricing
View Details
ER Degradation-Enhancing Alpha-Mannosidase-Like Protein 3 (EDEM3) Antibody
abx028901-02 400 µL

ER Degradation-Enhancing Alpha-Mannosidase-Like Protein 3 (EDEM3) Antibody

Sign In for Pricing
View Details
ARIH2 siRNA (Human)
orb1861188-01 15 nmol

ARIH2 siRNA (Human)

Sign In for Pricing
View Details
ARIH2 siRNA (Human)
orb1861188-02 30 nmol

ARIH2 siRNA (Human)

Sign In for Pricing
View Details
MRPL12 Recombinant Protein (Human)
OPCA05052-1MG 1 mg

MRPL12 Recombinant Protein (Human)

Sign In for Pricing
View Details