Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ngf protein

This Rat Ngf protein spans the amino acid sequence from region 122-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ngf, Ngfb, Beta-nerve growth factor, Beta-NGF

UniProt

P25427

Expression Region

122-241aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-tagged1-308AA: 122-241AAFull Length: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNK inhibitor 9
HY-124638-01 5 mg

MNK inhibitor 9

Sign In for Pricing
View Details
MNK inhibitor 9
HY-124638-02 10 mg

MNK inhibitor 9

Sign In for Pricing
View Details
MNK inhibitor 9
HY-124638-03 25 mg

MNK inhibitor 9

Sign In for Pricing
View Details
MNK inhibitor 9
HY-124638-04 50 mg

MNK inhibitor 9

Sign In for Pricing
View Details
MNK inhibitor 9
HY-124638-05 100 mg

MNK inhibitor 9

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus GMP reductase (guaC)
MBS1259230-01 0.02 mg (E-Coli)

Recombinant Acidovorax ebreus GMP reductase (guaC)

Sign In for Pricing
View Details