Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHIC2 protein

This Human CHIC2 protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BrX-like translocated in leukemia

UniProt

Q9UKJ5

Expression Region

1-165aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-258AA: 1-165AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAF2 Antibody - middle region : Biotin (ARP37341_P050-Biotin)
ARP37341_P050-Biotin 100 µL

YAF2 Antibody - middle region : Biotin (ARP37341_P050-Biotin)

Sign In for Pricing
View Details
10-Oxo Oxymorphone discontinued
411669 1 mg

10-Oxo Oxymorphone discontinued

Sign In for Pricing
View Details
YOD1 (NM_018566) Human Over-expression Lysate
LC413000 20 µg

YOD1 (NM_018566) Human Over-expression Lysate

Sign In for Pricing
View Details
CD19 Antibody
orb3053708-01 50 µL

CD19 Antibody

Sign In for Pricing
View Details
CD19 Antibody
orb3053708-02 100 µL

CD19 Antibody

Sign In for Pricing
View Details
RSL24D1 ORF Vector (Human) (pORF)
ORF009108 1.0 µg DNA

RSL24D1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details