Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP3R2 protein

This Human PPP3R2 protein spans the amino acid sequence from region 1-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcineurin B-like protein

UniProt

Q96LZ3

Expression Region

1-170aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-249AA: 1-170AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINA12 (Serpin A12, OL-64, Visceral Adipose Tissue-derived Serine Protease Inhibitor, Vaspin, Visceral Adipose-specific Serpin) (FITC)
MBS6149594-01 0.1 mL

SERPINA12 (Serpin A12, OL-64, Visceral Adipose Tissue-derived Serine Protease Inhibitor, Vaspin, Visceral Adipose-specific Serpin) (FITC)

Sign In for Pricing
View Details
SERPINA12 (Serpin A12, OL-64, Visceral Adipose Tissue-derived Serine Protease Inhibitor, Vaspin, Visceral Adipose-specific Serpin) (FITC)
MBS6149594-02 5x 0.1 mL

SERPINA12 (Serpin A12, OL-64, Visceral Adipose Tissue-derived Serine Protease Inhibitor, Vaspin, Visceral Adipose-specific Serpin) (FITC)

Sign In for Pricing
View Details
Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33)
MBS603174-01 0.1 mg

Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33)

Sign In for Pricing
View Details
Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33)
MBS603174-02 5x 0.1 mg

Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33)

Sign In for Pricing
View Details
IL-16 Rabbit Monoclonal Antibody (Detector)
E56PA0666 100 µL

IL-16 Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
Head & Neck cancer tissue array with unmatched normal adjacent tissues, 24 cases/48 cores with stage and grade data
HN481 1 Each

Head & Neck cancer tissue array with unmatched normal adjacent tissues, 24 cases/48 cores with stage and grade data

Sign In for Pricing
View Details