Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MARCKSL1 protein

This Human MARCKSL1 protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate

UniProt

P49006

Expression Region

1-195aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal GST-tagged1-307AA: 1-195AAFull Length of Isoform 2 : Full Length of BC066915

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD42b (PM6/40)
sc-59051 200 µg/mL

CD42b (PM6/40)

Sign In for Pricing
View Details
Rat Anti-Mouse IL-1 receptor antagonist Monoclonal Antibody
103-M413 100 µg

Rat Anti-Mouse IL-1 receptor antagonist Monoclonal Antibody

Sign In for Pricing
View Details
Ceritinib Impurity 24
RM-C051824-01 10 mg

Ceritinib Impurity 24

Sign In for Pricing
View Details
Ceritinib Impurity 24
RM-C051824-02 25 mg

Ceritinib Impurity 24

Sign In for Pricing
View Details
Ceritinib Impurity 24
RM-C051824-03 50 mg

Ceritinib Impurity 24

Sign In for Pricing
View Details
Ceritinib Impurity 24
RM-C051824-04 100 mg

Ceritinib Impurity 24

Sign In for Pricing
View Details