Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMM8A protein

This Human TIMM8A protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Deafness dystonia protein 1 X-linked deafness dystonia protein

UniProt

O60220

Expression Region

1-97aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-350AA: 1-97AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBeta3 Polyclonal Antibody
JOT-AP08981-01 20 µL

TGFBeta3 Polyclonal Antibody

Sign In for Pricing
View Details
TGFBeta3 Polyclonal Antibody
JOT-AP08981-02 50 μL

TGFBeta3 Polyclonal Antibody

Sign In for Pricing
View Details
TGFBeta3 Polyclonal Antibody
JOT-AP08981-03 100 µL

TGFBeta3 Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Recombinant Rabbit mAb
BS45133-01 50 µL

ZAP70 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ZAP70 Recombinant Rabbit mAb
BS45133-02 100 µL

ZAP70 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2 (ssaA2)
CSB-EP858183SKX-01 20 µg

Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2 (ssaA2)

Sign In for Pricing
View Details