Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2 (ssaA2)

Product Specifications

Product Name Alternative

SsaA2; SAV2299; Staphylococcal secretory antigen ssaA2

Abbreviation

Recombinant Staphylococcus aureus ssaA2 protein

Gene Name

SsaA2

UniProt

Q99RX4

Expression Region

28-267aa

Organism

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Target Sequence

SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Not known; immunogenic protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Not known; immunogenic protein.

Molecular Weight

42.7 kDa

References & Citations

"Whole genome sequencing of meticillin-resistant Staphylococcus aureus."Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y. Hiramatsu K.Lancet 357:1225-1240 (2001) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF568 conjugate, 0.1mg/mL
BNC682807-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wipf2 Mouse Gene Knockout Kit (CRISPR)
KN519433 1 Kit

Wipf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COP (CARD16) (N-term) Rabbit Polyclonal Antibody
AP51022PU-N 400 µL

COP (CARD16) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), Biotin conjugate, 0.1mg/mL
BNCB2883-500 1x 500 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SIGLEC5 Protein (His & Flag & Fc)
PKSH033530-01 10 µg

Recombinant Human SIGLEC5 Protein (His & Flag & Fc)

Sign In for Pricing
View Details
Recombinant Human SIGLEC5 Protein (His & Flag & Fc)
PKSH033530-02 50 µg

Recombinant Human SIGLEC5 Protein (His & Flag & Fc)

Sign In for Pricing
View Details