Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMM8A protein

This Human TIMM8A protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Deafness dystonia protein 1 X-linked deafness dystonia protein

UniProt

O60220

Expression Region

1-97aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-350AA: 1-97AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUM149 Cells
T1250 1x106 cells / 1.0 mL

SUM149 Cells

Sign In for Pricing
View Details
CCR5 (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (APC)
124489-APC 100 µL

CCR5 (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (APC)

Sign In for Pricing
View Details
DCAF11 Rabbit Polyclonal Antibody (Fluoro594)
orb3129671 100 µg

DCAF11 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
TBRG1 Peptide - C-terminal region
orb2004608 100 µg

TBRG1 Peptide - C-terminal region

Sign In for Pricing
View Details
Anti-RIP/RIPK1 Antibody Picoband® (FITC Conjugate)
PB9116-FITC 100 µg/Vial

Anti-RIP/RIPK1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
MRPL23 3'UTR GFP Stable Cell Line
TU064559 1.0 mL

MRPL23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details