TBRG1 Peptide - C-terminal region
TBRG1 Peptide - C-terminal region
Product Specifications
UniProt
Q3YBR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBRG1 Rabbit Polyclonal Antibody (orb584745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RG235459 10 µg
Glutathione S Transferase theta 1 (GSTT1) (NM_001293814) Human Tagged ORF Clone
Sign In for Pricing
View Details