Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C19orf48 protein

This Human C19orf48 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Multidrug resistance-related protein

UniProt

Q6RUI8

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-277AA: 1-117AAFull Length of BC020979 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNA13 Rabbit Polyclonal Antibody (HRP)
orb2090495 100 µL

GNA13 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CBLN2 Rabbit Polyclonal Antibody
TA316151 100 µL

CBLN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human WDR34 knockdown cell line
ABC-KD16910 1 Vial

Human WDR34 knockdown cell line

Sign In for Pricing
View Details
RGD1306583 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6644206 1.0 µg DNA

RGD1306583 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Difluoroacetyl Chloride
D381720 10 g

Difluoroacetyl Chloride

Sign In for Pricing
View Details
FSTL1 AAV Vector (Human) (CMV)
20994101 1 µg

FSTL1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details