Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNA13 Rabbit Polyclonal Antibody (HRP)

GNA13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G13

UniProt

Q14344

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNA13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (FITC)
MBS6342767-01 0.2 mL

RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (FITC)

Sign In for Pricing
View Details
RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (FITC)
MBS6342767-02 5x 0.2 mL

RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (FITC)

Sign In for Pricing
View Details
Esp4 (NM_001177583) Mouse Tagged Lenti ORF Clone
MR219653L3 10 µg

Esp4 (NM_001177583) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZP1 Protein Lysate (Mouse) with C-HA Tag
51943034 100 µg

ZP1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Neurochondrin (NCDN) (NM_001014839) Human Tagged ORF Clone Lentiviral Particle
RC216338L2V 200 µL

Neurochondrin (NCDN) (NM_001014839) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Macrophage inflammatory protein 5 AssayLite™ Antibody (PerCP Conjugate)
33071-05171 5x 30 µg

Human Macrophage inflammatory protein 5 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details