Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CROT protein

This Human CROT protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carnitine O octanoyltransferase, COT, CROT, OCTC_HUMAN, Peroxisomal carnitine acyltransferase, Peroxisomal carnitine O octanoyltransferase, Peroxisomal carnitine O-octanoyltransferase

UniProt

Q9UKG9

Expression Region

1-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-247AA: 1-87AAFull Length of BC063666 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-2-methoxy-4- (methylthio) pyridine
OR1099697 1 Each

5-Bromo-2-methoxy-4- (methylthio) pyridine

Sign In for Pricing
View Details
VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)
375848-01 20 µg

VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)

Sign In for Pricing
View Details
VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)
375848-02 100 µg

VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)

Sign In for Pricing
View Details
VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)
375848-03 1 mg

VSTM2L, Recombinant, Human, aa25-204, His-SUMO-Tag (V-set and Transmembrane Domain-containing Protein 2-like Protein)

Sign In for Pricing
View Details
Bovine CYCT Protein
orb1477246-01 20 µg

Bovine CYCT Protein

Sign In for Pricing
View Details
Bovine CYCT Protein
orb1477246-02 100 µg

Bovine CYCT Protein

Sign In for Pricing
View Details