Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CYCT Protein

This Bovine CYCT Protein spans the amino acid sequence from region 2-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3SZT9

Expression Region

2-105aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIWGEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r22 Protein Vector (Mouse) (pPM-C-HA)
PV246124 500 ng

Vmn2r22 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CYP4B1 (Cytochrome P450 4B1)
478960 100 µL

CYP4B1 (Cytochrome P450 4B1)

Sign In for Pricing
View Details
FOXP4 Rabbit Polyclonal Antibody
orb329919 100 µL

FOXP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
T-cell Surface Glycoprotein CD4 (CD4) Antibody (PerCP-Cy5.5)
abx200039 100 Tests

T-cell Surface Glycoprotein CD4 (CD4) Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal CDC5L Antibody [CoraFluor 1]
NB100-87013CL1 0.1 mL

Rabbit Polyclonal CDC5L Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Anti-Cat Haptoglobin Monoclonal
10-8214 1 mg

Anti-Cat Haptoglobin Monoclonal

Sign In for Pricing
View Details