Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFA1 protein

This Human DEFA1 protein spans the amino acid sequence from region 1-94aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, alpha 1 HNP-1

UniProt

P59665

Expression Region

1-94aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-236AA: 1-94AAFull Length of BC039318 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF92 Rabbit Polyclonal Antibody (Biotin)
orb2132207 100 µL

ZNF92 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CCL3 Protein Lysate (Human) with C-Ha Tag
15367031 100 µg

CCL3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Nucleocapsid (1E8) Monoclonal Antibody, AbBy Fluor™ 647 Conjugated
bsm-41268M-BF647-TR 20 µL

SARS-CoV-2 (2019-nCoV) Nucleocapsid (1E8) Monoclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)
APR29177N-01 50 µL

SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)

Sign In for Pricing
View Details
SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)
APR29177N-02 100 µL

SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)

Sign In for Pricing
View Details
SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)
APR29177N-03 200 µL

SARS-CoV-2 NSP15 Rabbit pAb (APR29177N)

Sign In for Pricing
View Details