Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF92 Rabbit Polyclonal Antibody (Biotin)

ZNF92 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TF12, HPF12, HTF12, HEL-203

UniProt

Q03936

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF92

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_009070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endophilin B1 (Y80) (SH3 Domain-containing GRB2-like Protein B1, Bax-interacting Factor 1, Bif-1, SH3GLB1, KIAA0491, CGI-61) (FITC) discontinued
S1013-31K5-FITC 200 µL

Endophilin B1 (Y80) (SH3 Domain-containing GRB2-like Protein B1, Bax-interacting Factor 1, Bif-1, SH3GLB1, KIAA0491, CGI-61) (FITC) discontinued

Sign In for Pricing
View Details
Olfactory receptor 1N1 Polyclonal Antibody
E44H05582 100 µL

Olfactory receptor 1N1 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR Rabbit Monoclonal Antibody
E56G2144 100 µL

Phospho-EGFR Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C1orf192 Rabbit Polyclonal Antibody (BF405)
orb2510314 100 µL

C1orf192 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
PRR24, CT (PRR24, Proline-rich protein 24) (MaxLight 650) discontinued
040505-ML650 100 µL

PRR24, CT (PRR24, Proline-rich protein 24) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TRAPPC4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV693213 1.0 µg DNA

TRAPPC4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details