Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTNNBIP1 protein

This Human CTNNBIP1 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibitor of beta-catenin and Tcf-4

UniProt

Q9NSA3

Expression Region

1-81aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-184AA: 1-81AAFull Length of BC069505 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD48/SLAMF2 Antibody (331504) [Janelia Fluor 549]
FAB3327I 0.1 mL

Rat Monoclonal CD48/SLAMF2 Antibody (331504) [Janelia Fluor 549]

Sign In for Pricing
View Details
OTC Peptide - C-terminal region
orb1997985 100 µg

OTC Peptide - C-terminal region

Sign In for Pricing
View Details
β Crystallin A3 Antibody [N15M18]
F3970-100uL*2 2x 100 μL

β Crystallin A3 Antibody [N15M18]

Sign In for Pricing
View Details
MMP26 Antibody
orb253333 100 µL

MMP26 Antibody

Sign In for Pricing
View Details
CD4 Antibody
MBS855064-01 0.1 mg

CD4 Antibody

Sign In for Pricing
View Details
CD4 Antibody
MBS855064-02 0.1 mL (AF405L)

CD4 Antibody

Sign In for Pricing
View Details