OTC Peptide - C-terminal region
OTC Peptide - C-terminal region
Product Specifications
Product Name Alternative
Sf, spf, AI265390
UniProt
P11725
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032795.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6224271-01 0.1 mL
Relaxin 1 (Rln1, Prorelaxin 1, Rln, Relaxin B Chain, Relaxin A Chain) (MaxLight 650)
Sign In for Pricing
View Details MBS6224271-02 5x 0.1 mL
Relaxin 1 (Rln1, Prorelaxin 1, Rln, Relaxin B Chain, Relaxin A Chain) (MaxLight 650)
Sign In for Pricing
View Details 
MBS6403185-01 0.1 mL
TSKS (Testis Specific Kinase Substrate, Testis-specific Serine Kinase Substrate, TSSKS, STK22 Substrate 1, Stk22s1, TSKS1) (MaxLight 650)
Sign In for Pricing
View Details MBS6403185-02 5x 0.1 mL
TSKS (Testis Specific Kinase Substrate, Testis-specific Serine Kinase Substrate, TSSKS, STK22 Substrate 1, Stk22s1, TSKS1) (MaxLight 650)
Sign In for Pricing
View Details 
