Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TCEB2 protein

This Human TCEB2 protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elongin 18KDA subunit Elongin-B

UniProt

Q15370

Expression Region

1-118aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-240AA: 1-118AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.Z antibody
MBS837313-01 0.1 mL

Histone H2A.Z antibody

Sign In for Pricing
View Details
Histone H2A.Z antibody
MBS837313-02 5x 0.1 mL

Histone H2A.Z antibody

Sign In for Pricing
View Details
PTMS (Parathymosin) (AP) discontinued
132046-AP 100 µL

PTMS (Parathymosin) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Claudin-2 (Cldn2)
orb2917597-01 20 µg

Recombinant Mouse Claudin-2 (Cldn2)

Sign In for Pricing
View Details
Recombinant Mouse Claudin-2 (Cldn2)
orb2917597-02 100 µg

Recombinant Mouse Claudin-2 (Cldn2)

Sign In for Pricing
View Details
2- (Acetyloxy) -1-[3,5-dimethoxy-4- (benzoyloxy) phenyl]ethanone
413964-01 5 mg

2- (Acetyloxy) -1-[3,5-dimethoxy-4- (benzoyloxy) phenyl]ethanone

Sign In for Pricing
View Details