Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-2 (Cldn2)

This Recombinant Mouse Claudin-2 (Cldn2) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Claudin-2

UniProt

O88552

Expression Region

1-230

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2,3-dihydro- (1H) -indole
269810-01 2 g

5-Chloro-2,3-dihydro- (1H) -indole

Sign In for Pricing
View Details
5-Chloro-2,3-dihydro- (1H) -indole
269810-02 5 g

5-Chloro-2,3-dihydro- (1H) -indole

Sign In for Pricing
View Details
5-Chloro-2,3-dihydro- (1H) -indole
269810-03 10 g

5-Chloro-2,3-dihydro- (1H) -indole

Sign In for Pricing
View Details
5-Chloro-2,3-dihydro- (1H) -indole
269810-04 25 g

5-Chloro-2,3-dihydro- (1H) -indole

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-01 48 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-02 96 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details