Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 57-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name, TNF-a

UniProt

P06804

Expression Region

57-235aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-338AA: 57-235AAFull Length: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC8A, CT (LRRC8A, KIAA1437, LRRC8, Leucine-rich repeat-containing protein 8A) (MaxLight 550) discontinued
037975-ML550 100 µL

LRRC8A, CT (LRRC8A, KIAA1437, LRRC8, Leucine-rich repeat-containing protein 8A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
3,4-Benzocoumarin 100mg
A19957-100 100 mg

3,4-Benzocoumarin 100mg

Sign In for Pricing
View Details
Lentiviral mouse Wfdc21 shRNA (UAS) - Lentiviral mouse Wfdc21 shRNA (UAS, GFP) (100)
GTR15196833 1 Vial

Lentiviral mouse Wfdc21 shRNA (UAS) - Lentiviral mouse Wfdc21 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
FAM90A5 CRISPR Knock Out 293T Cell Line (Human)
57348141 1x 10^6 Cells / 1.0 mL

FAM90A5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB)
orb2912378-01 20 µg

Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB)
orb2912378-02 100 µg

Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB)

Sign In for Pricing
View Details